noise eliminating ear plugs

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

Place of Origin:zhejiang

Brand Name:Other

Model Number:SEP 2

...ear plugs for noise reduction silicone reusable ear plugs for sleeping noise cancelling ear plugs noise cancelling Actual factory!!! More than 20 years Manufacture experience Ear plug for noise reduction: Different color: SPECIFICATION Product Name ear plug for noise reduction Place of Product China Type Ear plug...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of

Brand Name:Futuretech

Model Number:FTFE-02

Place of Origin:Shenzhen

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ...

Place of Origin:Guangdong, China

Brand Name:joyofswim

Model Number:KC-08

High Quality Waterproof Swimming Ear Plugs for Adults Product Overview Professional swimming ear plugs designed for surfing, swimming, and water sports. These waterproof ear plugs provide superior comfort and protection during aquatic activities. Product ...

Brand Name:Golden Moon

Model Number:YH-EK0322

Place of Origin:China

... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By Express Style: Hiphop,piercing Body Jewelry Type:

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Categories:Stainless Steel Ear Plug

Country/Region:china

... Payment T/T, Union Western, Paypal Shipping DHL,UPS,FedEx,E 1) Professional manufacturer of 316L surgical stainless steel Flesh tunnel, ear tunnel, fake plug, tunnel&plugs, ear expander, stainless steel and

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Brand Name:D-Jeesian

Model Number:H09-FEM19009

Place of Origin:GuangDong/China

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ...

Brand Name:YC

Model Number:YC-ED-0032

Place of Origin:China

Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zircon, Copper with long lasting rhodium plating...

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Model Number:PG-A1

...% Direct Factory Manufacturer & OEM/ODM Custom Sourcing Product Category: Custom Silicone Plugs (Industrial Silicone Rubber Components) Core Technical Specifications: Material Grade: 100% High-Grade Industrial Virgin Silicone (...

Place of Origin:Shenzhen, Guangdong Province

Brand Name:Swim bick

Model Number:earplug300

Durable Silicone Swimming Ear Plug Snorkeling Equipment Waterproof Ear Plugs Falling Resistant Professional silicone earplugs designed for swimming and snorkeling activities. These waterproof ear plugs provide reliable protection for both adults and ...

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

Brand Name:ZHONGYI

Model Number:HQ2EDGKM-5.0/5.08

Place of Origin:China

HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Rated current 10A Withstanding voltage AC1500V/...

Brand Name:N/A

Model Number:HR260519

Place of Origin:MADE IN CHINA

PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ green

Brand Name:Ringentle

Model Number:20006

Place of Origin:China

Punk round stainless steel thick wire hoop earrings - ear hooks for European and American use, anti-allergic ear plugs, pierced accessories.