| Sign In | Join Free | My infospaceinc.com |
|
All noise blocking ear plugs wholesalers & noise blocking ear plugs manufacturers come from members. We doesn't provide noise blocking ear plugs products or service, please contact them directly and verify their companies info carefully.
| Total 9418 products from noise blocking ear plugs Manufactures & Suppliers |
|
|
|
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Brand Name:Futuretech Model Number:FTFE-02 Place of Origin:Shenzhen ... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ... |
FUTURE TECH LIMITED
|
|
|
Brand Name:Golden Moon Model Number:YH-EK0322 Place of Origin:China ... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By Express Style: Hiphop,piercing Body Jewelry Type: |
Shenzhen Golden Moon Trade Ltd.
|
|
|
Brand Name:sweet Model Number:HT-034 Place of Origin:Ningbo ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs... |
Sweet Home International(H.K.)Limited
Zhejiang |
|
|
Brand Name:ZHONGYI Model Number:HQ2EDGKM-5.0/5.08 Place of Origin:China HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Rated current 10A Withstanding voltage AC1500V/... |
CIXI ZHONGYI ELECTRONIC EQUIPMENT FACTORY
Zhejiang |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Brand Name:Swim bick Model Number:EAR400 Place of Origin:China ... Waterproof & Noise Blocking Featuring a rotatable silicone wing structure: After inserting into the ear canal, twist the wings to create a 360° tight seal. It fully blocks pool/bath water from entering the ear and effectively reduces ambient noise (e.g. |
Kubick (Shenzhen) Plastic Products Co., Ltd.
Guangdong |
|
|
Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for WomenBrand Name:YC Model Number:YC-ED-0032 Place of Origin:China Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zircon, Copper with long lasting rhodium plating... |
Guangzhou Pullman Jewelry Co., Ltd.
Guangdong |
|
|
Place of Origin:China Brand Name:DISHINE Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing... |
Dishine International Limited
Zhejiang |
|
|
Brand Name:Beats Model Number:YLS135 Place of Origin:China Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Noise Cancelling Ear Pure Adaptive Noise Canceling (Pure ANC) function actively blocks external noise Real-time audio calibration gives you the best sound anytime Up to 22 hours of battery lasting... |
MONSTER TECH CO.,LTd
Guangdong |
|
|
Brand Name:D-Jeesian Model Number:H09-FEM19009 Place of Origin:GuangDong/China 1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ... |
Shenzhen D-Jeesian Bags Co., Ltd.
Guangdong |
|
|
Place of Origin:yangzhou Brand Name:Xinfly Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ... |
YANGZHOU XINFLY AMENITIES CO.,LTD
Jiangsu |
|
|
Brand Name:N/A Model Number:HR260519 Place of Origin:MADE IN CHINA PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ green |
LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Guangdong |
|
|
Brand Name:aomei Model Number:PSE-010 Place of Origin:China ... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the sweat. We are factory, the price is very competitive. |
Zhongshan Aomei Trade Co.,Ltd
Guangdong |
|
|
Brand Name:PDC Model Number:PDC124 Place of Origin:China Product Description: wholesale cool music headphone with noise blocking in four kinds of colors-black Material ABS, Aluminium or customized material. Color refer to the pictures in site or customized color ... |
Producentre (Dongguan) Electronic Co., Ltd
Guangdong |
|
|
Categories:3.5mm Single PIN earphone Country/Region:china Cheapest constellation in ear earphone with many colors Product Description Frequency 20-20,000 Hz Sensitivity 104±10%DB Impedance 32±2Ω Plug 3.5mm dual PIN Speaker 10mm Length 1.2m or customized Color multi Function Noise Cancelling Usage Airline,bus,... |
Yichun Yuanzhou District Heshi Electronics Co., Ltd.
|