Sign In | Join Free | My infospaceinc.com
infospaceinc.com
Products
Search by Category

noise blocking ear plugs

All noise blocking ear plugs wholesalers & noise blocking ear plugs manufacturers come from members. We doesn't provide noise blocking ear plugs products or service, please contact them directly and verify their companies info carefully.

Total 9294 products from noise blocking ear plugs Manufactures & Suppliers
Quality Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS for sale

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Quality PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Quality Waterproof Safety Foam Ear Plugs 26.4dB 23.6inch 60cm Reusable Noise Cancelling Ear Plugs for sale

Brand Name:Futuretech

Model Number:FTFE-02

Place of Origin:Shenzhen

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ...

FUTURE TECH LIMITED
Verified Supplier

Quality Flexible Shooting Ear Plugs ROHS Custom Silicone Parts for sale

Brand Name:OEM

Model Number:OEM

Place of Origin:CHINA

... use sealing characteristics of silicone material then designed to meet the human ear structure, a rubber ear plug can protect the eardrum by noise damage effectively. Silicone Ear Plugs are common used in electronic products to output voice,swimming to

Xiamen Juguangli Import & Export Co., Ltd
Verified Supplier

Fujian

Quality OEM Pyrex Glass Ear Plugs 13mm Stainless Steel Handmade Piercing Jewelry for sale

Brand Name:Golden Moon

Model Number:YH-EK0322

Place of Origin:China

... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By Express Style: Hiphop,piercing Body Jewelry Type:

Shenzhen Golden Moon Trade Ltd.
Active Member

Quality Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff for sale

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Sweet Home International(H.K.)Limited
Active Member

Zhejiang

Quality 300V 10A M2.5 Screw Fixed Ear Plug-In Brass Terminal Block for sale

Brand Name:ZHONGYI

Model Number:HQ2EDGKM-5.0/5.08

Place of Origin:China

HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Rated current 10A Withstanding voltage AC1500V/...

CIXI ZHONGYI ELECTRONIC EQUIPMENT FACTORY
Verified Supplier

Zhejiang

Quality Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Quality 【Waterproof and Noise-Blocking】Rotating Silicone Earplug Case: Multiple colors available + Portable Storage, Suitable for Swimming / Bathing for sale

Brand Name:Swim bick

Model Number:EAR400

Place of Origin:China

... Waterproof & Noise Blocking Featuring a rotatable silicone wing structure: After inserting into the ear canal, twist the wings to create a 360° tight seal. It fully blocks pool/bath water from entering the ear and effectively reduces ambient noise (e.g.

Kubick (Shenzhen) Plastic Products Co., Ltd.
Verified Supplier

Guangdong

Quality Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women for sale

Brand Name:YC

Model Number:YC-ED-0032

Place of Origin:China

Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zircon, Copper with long lasting rhodium plating...

Guangzhou Pullman Jewelry Co., Ltd.
Active Member

Guangdong

Quality Pu Foam Ear Plugs for sale

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Dishine International Limited
Active Member

Zhejiang

Quality Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Noise Cancelling Ear for sale

Brand Name:Beats

Model Number:YLS135

Place of Origin:China

Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Noise Cancelling Ear Pure Adaptive Noise Canceling (Pure ANC) function actively blocks external noise Real-time audio calibration gives you the best sound anytime Up to 22 hours of battery lasting...

MONSTER TECH CO.,LTd
Active Member

Guangdong

Quality Lightweight Memory Foam Eye Mask With Ear Plugs / Adjustable Strap for sale

Brand Name:D-Jeesian

Model Number:H09-FEM19009

Place of Origin:GuangDong/China

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ...

Shenzhen D-Jeesian Bags Co., Ltd.
Active Member

Guangdong

Quality Pu foam Ear plugs,Earplugs,Foam ear plugs ,CE EN 352-2 Bullet PU Foam Ear plugs for sale

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

YANGZHOU XINFLY AMENITIES CO.,LTD
Active Member

Jiangsu

Quality noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone for sale

Brand Name:N/A

Model Number:HR260519

Place of Origin:MADE IN CHINA

PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ green

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Site Member

Guangdong

Quality Sport ear plug Bluetooth earphone run headphone with hook best sellers in 2017 for sale

Brand Name:aomei

Model Number:PSE-010

Place of Origin:China

... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the sweat. We are factory, the price is very competitive.

Zhongshan Aomei Trade Co.,Ltd
Active Member

Guangdong

Quality wholesale cool music headphone with noise blocking in four kinds of colors with soft ear pads sound reduction for adults for sale

Brand Name:PDC

Model Number:PDC124

Place of Origin:China

Product Description: wholesale cool music headphone with noise blocking in four kinds of colors-black Material ABS, Aluminium or customized material. Color refer to the pictures in site or customized color ...

Producentre (Dongguan) Electronic Co., Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request