Sign In | Join Free | My infospaceinc.com
infospaceinc.com
Products
Search by Category
Home > Machinery > Environmental Machinery > Noise Reduction Device >

Noise Reduction Ear Protection

noise reduction ear protection

All noise reduction ear protection wholesalers & noise reduction ear protection manufacturers come from members. We doesn't provide noise reduction ear protection products or service, please contact them directly and verify their companies info carefully.

Total 23962 products from noise reduction ear protection Manufactures & Suppliers
Quality Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS for sale

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Quality Electronic ANSI Noise Reduction Ear Muff Adjustable ABS Material Customized for sale

Brand Name:Future Tech

Model Number:FT0014

Place of Origin:Shenzhen China

...Protection of the Ear Muffs ANSI specification Description of Electronic Ear Muffs : ①Fit to ear Human body leather material, comfortable experience,reduce pressure on the ear,fit the face. ② Comfortable to wear Simple and fashionable wear,seismic fiber material,good elasticity,strong pedestrian use for a long time. ③ Good protection...

FUTURE TECH LIMITED
Verified Supplier

Quality Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4 for sale

Brand Name:PDC

Model Number:PDC139

Place of Origin:China

Product Description Product name Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4 Material ABS, Aluminium or customized material. Color refer to the pictures in site or customized color MOQ 3000 pieces Price EX ...

Producentre (Dongguan) Electronic Co., Ltd
Active Member

Guangdong

Quality 5mm Polyester Fiber Board Walls Decorative Noise Reduction Fire Protection for sale

Brand Name:WL

...Noise Reduction Fire Protection Wall Panel Pet Felt 100% Polyester Fibre Acoustic Panel Product type Polyester fiber panel/PET sound absorbing panel Product specification Chromatic PET panels:1220*2420*9/12mm;High density fiber panels:2500/3000*1210*5/9mm Structure Made of high-quality fiber and covered with sound-permeable fabric finish Density 100~600kg/m3 Acoustics Noise reduction coefficient nRC 0.75 Fire protection...

Chengdu Yixing Amber Decoration Design Co., Ltd.
Verified Supplier

Sichuan

Quality PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Quality Adjustable Height Plastic Bracket Polycarbonate PC Sheet  Canopy With Noise Reduction Rain Protection for sale

Brand Name:TOPPC

Model Number:TOPPC21

Place of Origin:China

...both plastic and aluminum, manufactured by our trusted Aluminum bracket factory to ensure the highest quality and durability. In addition to sun and rain protection, our DIY PC Canopy also has the added feature of reducing noise. This makes it the perfect

Foshan Huaxia Nature Building Materials Co., Ltd.
Verified Supplier

Guangdong

Quality Black Wiring Harness Tape For Noise Reduction And Protection Against High Temperature Automotive Wiring Harness for sale

Brand Name:Yihong

Model Number:0628

Place of Origin:Guangdong Dongguan

Company Profile *, *::before, *::after {box-sizing: border-box;}* {margin: 0;}html, body {height: 100%;}body {line-height: 1.5;-webkit-font-smoothing: antialiased;}img, picture, video, canvas, svg {display: block;max-width: 100%;}input, button, textarea, ...

Dongguan Yihong Adhesive Technology Co., Ltd.
Active Member

Guangdong

Quality Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-HP-...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Quality TWS Full Range Noise Reduction JL V40 In Ear Wireless Earphones for sale

Brand Name:Vizz/ Retorz/ OEM

Model Number:RT- V40

Place of Origin:China

..., TWS smart headphones will play an important role in the fields of wireless connection, voice interaction, intelligent noise reduction, health monitoring, and hearing enhancement/protection. It is not only a standard configuration of smart phones,

Shenzhen Hosing Technology Development Co., Ltd.
Verified Supplier

Guangdong

Quality Noise Reduction Electronic Ear Protection For Eyeglasses Outdoor for sale

Brand Name:HONY

Model Number:Earmuffs

Place of Origin:Guangdong China

...noise reduction earmuffs, match the bluetooth music glasses are perfect group. When you listening to music, wear the noise reduction earmuffs, you will get music much more surround sound. It is perfect choice if you are at Station, shopping mall, subway or

Shenzhen HONY Optical Co., Limited
Active Member

Guangdong

Quality Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff for sale

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear...

Sweet Home International(H.K.)Limited
Active Member

Zhejiang

Quality Leather Waterproof Headphone Ear Pads Thickness 2cm Noise Reduction for sale

Brand Name:Cree

Place of Origin:Guangdong, China

...Noise Reduction Product Description: Headphone Earpads provide excellent noise reduction and comfort for users. It comes with multi-color choice, such as black, to fit with different preferences. The round shape is designed for a snug fit and breathability, and can also be customized for brands. With advanced noise reduction...

Dongguan Kerui Automation Technology Co., Ltd
Verified Supplier

Guangdong

Quality EM123 CE EN352 34dB ABS Shell Safety Earmuffs Effective Noise Reduction For Ears for sale

Place of Origin:Zhejiang, China

Brand Name:WELWORK

Model Number:EM123

... filter Earmuff NRR 31dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per polybag,50pcs per carton Terms of Payment T/T Port of

Ningbo Welwork Ppe Co., Ltd.
Verified Supplier

Zhejiang

Quality Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Quality Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Quality ANC true wireless waterproof sport earbuds wholesale 1562a wireless in ear TWS Noise Reduction Headset for sale

Brand Name:OEM

Model Number:XY-50-1

Place of Origin:Guangdong,China

... XY-50 TWS bluetooth earphone with charge case ear sensor earbuds bluetooth 3 pairs free ear tips freebuds ANC tws earbuds With a noise reduction depth of -28DB, it cut out the lower frequency noises like trains,bus,busy srteetts and so on,makes you focus...

SoKe Electronic Co.,Ltd
Active Member

Guangdong

Quality Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof for sale

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier

Anhui

Quality Rechargeable Invisible Digital Hearing Amplifier With Noise Reduction for sale

Brand Name:Retone

Model Number:K419

Place of Origin:Shenzhen, China

...Noise Reduction Super Effective Hearing Assist - Ideal for most mild to moderate hearing loss. With noise reduction, these small devices will bring you back in the clear world. Completely-in-Canal - Very small and lightweight, no burden for ears for long time using. Great for people wearing glasses or masks. State of the Art Design - Blue device for left ear, red device for right ear...

Retone shenzhen Technology Co., Ltd.
Active Member

Quality True Wireless Bluetooth Earphone HiFi Stereo In Ear Headphone ENC ANC Call Noise Reduction for sale

Brand Name:OEM/ODM

Model Number:LD-WBE025

Place of Origin:China

... Earphones HiFi Stereo In Ear Headphone ENC ANC Call Noise Reduction Audio Buds Feature: Product Name: Wireless Earbuds Bluetooth XY-70 [Bluetooth Version] Bluetooth 5.1 [Charging compartment battery] 400mah (with protective plate) [Speaker] F10mm ...

Shenzhen Landeal Electric Limited
Active Member

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request