noise reduction cr sealed foam

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

... CR rubber and plastic products are new environment-friendly plastic foam materials. Good physical and mechanical properties,oil resistance,heat resistance,fire resistance,daylight resistance,ozone resistance,...

Brand Name:JFZ

Place of Origin:guangzhou

Product Details Leather sound-absorbing panel: Using leather or perforated leather veneer, it combines sound-absorbing and high-end texture. Fireproof and sound-absorbing soft package: The core material is A-grade fireproof glass fiber cotton, and the ...

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product Parameters Model L -

Brand Name:SR

Model Number:Sealer Foam Gasket

Place of Origin:CHINA

...Foam Gasket for Commercial and Household Vacuum Machines | OEM Vacuum Packaging Machine CR Foam Seal | Industrial Sealing Foam Supplier Vacuum Sealer Foam is specially designed for vacuum packaging machines to provide excellent airtight sealing performance. Made from high-quality CR foam materials, it offers strong resilience, durability, wear resistance, and long service life. The foam seal...

Brand Name:FQ

Model Number:FQ01

Place of Origin:China

... foam, offering excellent buffering, protection and sealing for your EV battery pack. It has excellent shock absorption, high flexibility, great heat and chemical resistance, and excellent durability. Our EV battery sealing EPDM rubber foam is designed to

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Brand Name:No brand

Model Number:EVA 30-G

Place of Origin:China

... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and even ...

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

... speech and signals. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. Good inner space for ear. With CE standard. Direction of Use Pull the cups ...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Brand Name:Yuchai

Place of Origin:Nanjing, China

Model Number:S04-1003240-E85-01

... oil containment and quiet operation.Key Features Genuine Yuchai: OEM quality replacement Labyrinth Seal: High-efficiency oil leak prevention Noise Reduction: Built-in acoustic dampening Stable Operation: Wide temperature range performance Contact us for