foam for noise reduction

Brand Name:CTF

Model Number:TGD 3510 PO

Place of Origin:China

... 3510 PO Foam) is a foam product obtained through the processes of blending polyethylene with foaming agents and auxiliaries, followed by extrusion and foaming. Further processing includes laminating with aluminum film and adhesive backing to produce the

Categories:EVA Foam Underlayment

Country/Region:china

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Brand Name:Future Tech

Model Number:FT004

Place of Origin:Shenzhen China

Description of the Hot Sale High Quality Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon...

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

Model Number:Z-Foam800-10SEC

Brand Name:Ziitek

Place of Origin:China

...Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications Product Overview Z-Foam ®800-10SEC Series combines the inherent advantages of silicone polymer, including high/low temperature resistance, UV/ozone resistance, weatherability, electrical insulation, and environmental safety. With the lightweight, acoustic damping, and vibration-damping properties of foam...

Place of Origin:Qingdao, China

Brand Name:huashida

...Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption Product Overview Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam...

Model Number:SR

Brand Name:SR

Place of Origin:CHINA

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, sound insulation, and durability. This product is

Brand Name:EkkoFlex

Place of Origin:Made in china

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ...

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters / PU Foam Roller Shutter Product Description Our Noise Reduction Aluminum Foam Filled Roller Shutters provide superior sound insulation combined with enhanced security features, making them ideal for ...

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Brand Name:JIRUI

Model Number:CX0042

Place of Origin:CHINA

...vehicle, such as the doors, floor, roof, and firewall. Their strategic placement and combination can effectively minimize noise and improve overall comfort. 2,MPV cars are often used for family outings or group travel, and a quiet interior is essential for

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Brand Name:BILIN

Model Number:S3

Place of Origin:China

Description: BILIN S3 Spray PU Foam is resistant to aging, moisture, and temperature fluctuations, ensuring reliable insulation performance for years. Unlike traditional insulation materials, it won’t sag or degrade over time, maintaining airtight seals...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of